PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000281973
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 314aa    MW: 35698.4 Da    PI: 5.1533
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000281973genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26094.98.7e-3079174398
         DUF260   3 aaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                    +aCk++rrkC++ C la yfpa++  +f n+h++FG+snv k+++++++++r++a+++++ e++++ ++P  G++gv + l +q++ +++el++++
  MDP0000281973  79 SACKYQRRKCNQTCGLAAYFPASRFVEFVNAHHMFGMSNVEKIIATVEPDQRPAAAETILLEGNIWRNNPSVGCLGVTRFLLEQVDFHEKELEVTN 174
                    69*****************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.9276177IPR004883Lateral organ boundaries, LOB
PfamPF031958.1E-2779173IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MERGMKGRIG EDMVWLYVIG WAVLLLQFLG IFAMLYSPVH AELLAAAELL AARRAAELLM  60
EFQSAISNLV LEGGSTKNSA CKYQRRKCNQ TCGLAAYFPA SRFVEFVNAH HMFGMSNVEK  120
IIATVEPDQR PAAAETILLE GNIWRNNPSV GCLGVTRFLL EQVDFHEKEL EVTNRYLAFY  180
RELKKQFDSL KIQSAQEASV VPDQFPQITA EMKMYEERYI YMSSLEDAQE KTFDIGLMQP  240
ASFNGPGKSR ETSKQFEIGF KSSGIDHCAT SFDEMANRLE PEIQEDHXLR NEGYRVPKTQ  300
NCREDGSRKE IDVQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009352702.11e-82PREDICTED: LOB domain-containing protein 22-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-27LOB domain-containing protein 22